PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00128.1_g00043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 288aa    MW: 32275.8 Da    PI: 8.7136
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00128.1_g00043.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.3e-171461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEde+l  ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Rsa1.0_00128.1_g00043.1 14 KGAWTKEEDERLTAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                             79******************************99************97 PP

2Myb_DNA-binding59.95.6e-1967111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Rsa1.0_00128.1_g00043.1  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.879961IPR017930Myb domain
SMARTSM007172.8E-131363IPR001005SANT/Myb domain
SuperFamilySSF466899.17E-3013108IPR009057Homeodomain-like
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001675.95E-101661No hitNo description
PROSITE profilePS5129429.41162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2865117IPR009057Homeodomain-like
SMARTSM007176.3E-1866114IPR001005SANT/Myb domain
PfamPF002493.7E-1767111IPR001005SANT/Myb domain
CDDcd001677.38E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLTAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLINRG  120
IDPTTHRPVQ ESSSASHDSK PTQLEAITNN TIHISFTSTP KMESTSFQVK PEKISMLTFK  180
EEKDESPIEA KLPDLNLELR ISLPDVVDHR HQVLVVGEGK STRARCFRCS LGMINGMECR  240
CGSMRCDVVG GSSGSGKGSD ISNGFDFLGL ATRETTTSLL GFRSLEMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR0765500.0KR076550.1 Brassica napus MYB transcription factor 4-2 (MYB4-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596010.11e-180PREDICTED: transcription repressor MYB4
SwissprotQ9SZP11e-176MYB4_ARATH; Transcription repressor MYB4
TrEMBLA0A078DM720.0A0A078DM72_BRANA; BnaA08g16990D protein
STRINGBra010736.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-167myb domain protein 4